PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr2P19890_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family MYB
Protein Properties Length: 792aa    MW: 87617.9 Da    PI: 4.905
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr2P19890_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.29.3e-194793148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g WT+eEd +l++av+++ g++Wk+Ia++++  Rt+ qc +rwqk+l
  GSMUA_Achr2P19890_001 47 KGQWTAEEDAILYKAVERFKGKNWKKIAECFP-DRTDVQCLHRWQKVL 93
                           799*****************************.************986 PP

2Myb_DNA-binding61.41.9e-1999145148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            +g+W++eEde++++ vk++G++ W+tIa+ ++ gR +kqc++rw+++l
  GSMUA_Achr2P19890_001  99 KGPWSKEEDEIIIEMVKKFGPKKWSTIAQALP-GRIGKQCRERWHNHL 145
                            79******************************.*************97 PP

3Myb_DNA-binding48.22.5e-15151193145
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                            + +WT+eE+  l++a++ +G++ W+   + ++ gRt++ +k++w+
  GSMUA_Achr2P19890_001 151 KEPWTQEEEIALIHAHQIYGNK-WAELTKFLP-GRTDNAIKNHWN 193
                            679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.7314293IPR017930Myb domain
SuperFamilySSF466892.21E-1643100IPR009057Homeodomain-like
SMARTSM007173.2E-164695IPR001005SANT/Myb domain
PfamPF002491.7E-164793IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-2449109IPR009057Homeodomain-like
CDDcd001671.03E-145093No hitNo description
PROSITE profilePS5129432.51794149IPR017930Myb domain
SuperFamilySSF466894.31E-3296192IPR009057Homeodomain-like
SMARTSM007171.8E-1898147IPR001005SANT/Myb domain
CDDcd001672.64E-16101145No hitNo description
PfamPF139214.0E-19102162No hitNo description
Gene3DG3DSA:1.10.10.604.4E-27110153IPR009057Homeodomain-like
SMARTSM007178.2E-15150198IPR001005SANT/Myb domain
PROSITE profilePS5129419.668150200IPR017930Myb domain
CDDcd001671.31E-11153193No hitNo description
Gene3DG3DSA:1.10.10.604.6E-22154201IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 792 aa     Download sequence    Send to blast
MASDKGKNSV KGEASSSNAA HEGIGQEIQK QRSLNGRTTG PTRRSTKGQW TAEEDAILYK  60
AVERFKGKNW KKIAECFPDR TDVQCLHRWQ KVLNPELVKG PWSKEEDEII IEMVKKFGPK  120
KWSTIAQALP GRIGKQCRER WHNHLNPSIN KEPWTQEEEI ALIHAHQIYG NKWAELTKFL  180
PGRTDNAIKN HWNSSVKKKL NSYLASGLLS QFKGLPNVES PTQVGNMQKN NDHGLKDRLE  240
VEDSSECSQA STANVGWYQS DGELPNTVSV DDDIKLDGDS NRKEIQDSQL SMCTNEYYAS  300
MEEFARAVPE VQCEASTSAN LLPEEMSEKV SDRMILDELP NDSSLEVSQK SFELTEASEH  360
YSLCTRNNEN ASVLWSKFLD LKVPTFILNN DSRYEKQNNL LACETDCCNN NLYGLDYFSG  420
INCQNSFGSE AGGSLGSCSN PIYPVSSSAV PGISYCNNLM AVVPPSYLCP SDEKLQRNST  480
HETREIFVGA HDSEVITCSY DGFAYSSCSS LCPNDSSIPN VCLLEDKGQE IGTPKHTHTE  540
MMVSGTPDAN HNITLSDGNP TQPAELQDSG ALFYEPPRFP SLEIPFVSCD LIPSVDLQQA  600
YSPLGIRQLM MSSVSCSKPY SLWDSPSHDE SPDALLKSAA KSFMCTPSIM KKRQRELSSP  660
MVEQRIDKKP GIEMPCGSLH SSPLSNTENS SMVNLNGAVV LNEISSGYAE GGFTSSDNQQ  720
KEPVLLDEDK ENLCQSSGCA TNGNINKEVK SSTDLSDKMT SSTVTISVAA KSDAGSSRRR  780
FMWLIDLIMI MT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C3e-68472006159MYB PROTO-ONCOGENE PROTEIN
1h88_C3e-68472006159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00466DAPTransfer from AT4G32730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009389964.10.0PREDICTED: myb-related protein 3R-1-like isoform X1
RefseqXP_009389965.10.0PREDICTED: myb-related protein 3R-1-like isoform X1
RefseqXP_009389966.10.0PREDICTED: myb-related protein 3R-1-like isoform X2
TrEMBLM0S9I00.0M0S9I0_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P19890_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.11e-157Homeodomain-like protein